PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10002435
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 322aa    MW: 35673.7 Da    PI: 6.9858
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10002435genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.24.6e-141561248
                     SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     grW++eEd+ll+ ++   G g+W++ ++  g++R++k+c++rw +yl
      Lus10002435 15 GRWSAEEDQLLAGYIVANGEGSWRSLPQNAGLKRCGKSCRLRWVNYL 61
                     9********************************************97 PP

2Myb_DNA-binding45.71.6e-1467112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+ +t E e ++++++ lG++ W+tIa+ ++ gRt++++k++w+++l
      Lus10002435  67 RGNISTAEAETILNLHTCLGNR-WSTIASQLP-GRTDNEIKNYWNSHL 112
                      7899******************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.7E-19564IPR009057Homeodomain-like
PROSITE profilePS5129413.015961IPR017930Myb domain
SuperFamilySSF466896.25E-2512108IPR009057Homeodomain-like
SMARTSM007178.3E-91363IPR001005SANT/Myb domain
PfamPF002497.6E-131461IPR001005SANT/Myb domain
CDDcd001671.41E-61661No hitNo description
PROSITE profilePS5129419.98762116IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.5E-2265115IPR009057Homeodomain-like
SMARTSM007178.1E-1166114IPR001005SANT/Myb domain
PfamPF002495.6E-1167112IPR001005SANT/Myb domain
CDDcd001676.95E-771112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 322 aa     Download sequence    Send to blast
MGRKPCCDKE GLKTGRWSAE EDQLLAGYIV ANGEGSWRSL PQNAGLKRCG KSCRLRWVNY  60
LKSDIKRGNI STAEAETILN LHTCLGNRWS TIASQLPGRT DNEIKNYWNS HLSRNTHSFI  120
GPTAPQPNLA TLVADMAKVV TTVVANTKRG RKTNNSSSKR TKNDKTNISK DTRTNVVSEP  180
SVVEKAVVTI NGPETGLATT TKHPSPISYI SDETTCSGVM KVQQYNASLS SATEIPASPW  240
EKSFLYYEQW DMDKDWDDVV SYCTKTSTMD STVNQLIGWS WELYAGDCGL EAGRHNGVLE  300
FDDRDNDDND KQTGFVDWLL S*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-20121165108B-MYB
1h8a_C7e-201211425126MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010523975.11e-67PREDICTED: transcription factor MYB12-like isoform X2
TrEMBLA0A0S2T0F23e-67A0A0S2T0F2_ERYLE; Light areas 1
STRINGPOPTR_0010s15090.13e-64(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47460.18e-65myb domain protein 12